PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000256105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 484aa    MW: 53223.3 Da    PI: 6.3685
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000256105genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY924.5e-29112170160
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    ldDgy+WrKYGqK vkg+ + rsYYrCt+++C+vkk+ver+   +++++++Y geH+h+k
  MDP0000256105 112 LDDGYHWRKYGQKFVKGNSYVRSYYRCTHPKCEVKKQVERAL-SGQITDTVYFGEHEHPK 170
                    59****************************************.9**************85 PP

2WRKY103.61.1e-32283340259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vkg+++prsYYrC+ +gCpvkk+ver+++d kvv+ tYeg+H+h+
  MDP0000256105 283 SDGYRWRKYGQKLVKGNPNPRSYYRCSNPGCPVKKHVERASHDSKVVIATYEGQHDHD 340
                    8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-26105170IPR003657WRKY domain
PROSITE profilePS5081121.345107171IPR003657WRKY domain
SuperFamilySSF1182901.44E-23110170IPR003657WRKY domain
SMARTSM007749.4E-33112170IPR003657WRKY domain
PfamPF031061.5E-23113169IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-35268342IPR003657WRKY domain
SuperFamilySSF1182904.58E-29274342IPR003657WRKY domain
PROSITE profilePS5081135.462277342IPR003657WRKY domain
SMARTSM007741.1E-37282341IPR003657WRKY domain
PfamPF031061.3E-25284339IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MIPLGXDGTD KVASDIVQKK ESSDSEIHVP HQAPNKGICP LQSDHKGXAQ FLTPEKASQV  60
PDGVVTASQP NQEGSASSLT SEKTPQTPET AALALQSAQE GTTPSTTLKR VLDDGYHWRK  120
YGQKFVKGNS YVRSYYRCTH PKCEVKKQVE RALSGQITDT VYFGEHEHPK LRSVPVAVSF  180
VVSIVEDERP KVLLLTDVED KSSNAHXHES NQIEPVDPPQ LSSVAVTEAV QGVLSQSNRP  240
RDGDPDPIRQ KKAKHNGNSL XVDKPAVEPR MVVQTMSEVD IVSDGYRWRK YGQKLVKGNP  300
NPRSYYRCSN PGCPVKKHVE RASHDSKVVI ATYEGQHDHD MPPTRTVTHN TAASNVFTTA  360
RICESGTXPE GNAVCRDTSP EHEVKPSEQR KDESKTKPSD VAGSDMVVDS DLGSERTLHD  420
QSVAEACTTT EXDPPYMIVC RANXKKTIEM GIKSEGVDMV XCDNLRPESN PPEQEKPKAE  480
PVDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A8e-37107343275WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.270961e-179fruit| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2297561e-49KP229756.1 UNVERIFIED: Boehmeria nivea WRKY transcription factor-like (WRKY27) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379978.10.0PREDICTED: WRKY transcription factor 1-like
SwissprotQ9SI374e-81WRKY1_ARATH; WRKY transcription factor 1
TrEMBLM5X4P50.0M5X4P5_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93583343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.24e-84zinc-dependent activator protein-1